PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G176655_P01
Common NameLOC100381753, NLP8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Nin-like
Protein Properties Length: 873aa    MW: 97633.4 Da    PI: 7.6396
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G176655_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.45e-27515565252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+ sle++++yF +++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  GRMZM2G176655_P01 515 EKTFSLEVIQQYFTGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 565
                        7899********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.972503585IPR003035RWP-RK domain
PfamPF020423.8E-24518565IPR003035RWP-RK domain
SuperFamilySSF542771.65E-22772864No hitNo description
PROSITE profilePS5174520.444779861IPR000270PB1 domain
SMARTSM006663.9E-25779861IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2409.0E-25780860No hitNo description
CDDcd064075.37E-30780860No hitNo description
PfamPF005645.3E-18780860IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 873 aa     Download sequence    Send to blast
MAATLGCSTP CPRRSTFRPF RPRCRRRGRA ATRIILPCGW TRLPCKTTAR ASPPEKLTVA  60
LMYFKESTKQ HLLVQVWVPI RKGDHYMLST SGQPFVLDEQ SIGLLDYRAV SMMYTFAVDG  120
DSVEELGLPG RVYKQRLPEW TPDVQYYSSI EYARLNHAIS YDVHGTVALP VFDSSMKSCI  180
AVVELIMTSK KVNYAREVGE VSKALEAVNL KSTEVIEHPY VQIFNEGHQN VLVEMLEIIT  240
VICEELKLPI AQTWVPCKYQ NLLIHCGGEN KSCFDIHESC AQELCMSTSA VMFHIIDAHM  300
WGFRDACVEH HLKKGQGVSG KAFILRRPCF TKDVTRFSKM EYPLVHYARM FGLAGCFSIC  360
LQSAYNRNED YVLEFFLPPD CREDGEQKVL LDSILALLRQ YLNRLQVATD EGSNEVYLQV  420
DAITIIENGD IKNAHVQHMN CEGGIHASDE RNMHVIHESD SQKRISPTES ETCPSPDNTK  480
CNDKLFARQN GGCISDSLLL ENNSKHSGRR QGKEEKTFSL EVIQQYFTGS LKNAAKSLGV  540
CPTTMKRICR QHGISRWPSR QISKVNRTVS KLKKVIESVE GHEGAFTLTS VTGPLPVAFG  600
PSNPISIKNQ SQINVSGLPI PSVQENRDSS SQSKLLENDI HRSTLVPQKS FLANINRQIE  660
AEKASNSRNS SKDCRTHSGR SEESYPVSPA NMTFVSTLLE PQQNMYIQDG FTKESFQKED  720
LRFHGMFVNG SGSLKDCMNH ITSAVNGTII GHPGSLTTAQ NSGIITCPGS LISAQNSRIV  780
TVKARYKEDL LRFRFPCSGS FITLKDEVAK RIQMDGVLFD IKYLDDDHEW VKLTCDTDLE  840
ECMEISRASG SNVLRLLVTD IAPVLGSSCG STG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1041980.0meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G176655
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G176655_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0621770.0BT062177.1 Zea mays full-length cDNA clone ZM_BFb0224E14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001168027.10.0NLP transcription factor
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLC0HIM10.0C0HIM1_MAIZE; NLP transcription factor
STRINGGRMZM2G176655_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7